Protein Info for SMc01633 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 253 to 277 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 273 (187 residues), 42.5 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 39% identical to POTB_HAEIN: Spermidine/putrescine transport system permease protein PotB (potB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_2225)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG0 at UniProt or InterPro

Protein Sequence (288 amino acids)

>SMc01633 ABC transporter permease (Sinorhizobium meliloti 1021)
MRVATNTKRNLVTAALIAPAAVWLTVFLVLPFIAMLVFAFGERAPEGGYQPAFTFAQFAN
LPTRAAAFWNTLMLAPAGALLCLVVAYPVAYYLAVKANPRYRLILVSLVVVPFWTSLLVR
TYAWMYILGSRGIPNLLSMIGIEDVRMLNTPGAVLLGIVYGYLPLMIMPIYVSLEKLDRR
LLEASADLGGKPVSTFLGVTLPLSLPGVMTGVALVTILLLGEYLIPQLLGGGKVFFIGNA
LVDLFLQSRNWPFGSAIAVTLVAVVVVVLMVAMRIAWKVAGTRQVDLV