Protein Info for SMc01626 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 198 to 227 (30 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 274 (177 residues), 55.5 bits, see alignment E=3.2e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SMc01626)

Predicted SEED Role

"Predicted erythritol ABC transporter 1, permease component 2" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92NG7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>SMc01626 ABC transporter permease (Sinorhizobium meliloti 1021)
METTSPVERLLRGVALTLVVVFFMFPIVWIFLMSFQTNETILRIPPSVVFTPTLENYAAL
ITGKLQTASGTLDIAFMRNLGNSVLLSVASVALALVLGVPAAYAFARHKFRGSEDIAFTL
LSFRFAPPLLVLLPLTQYFQWLGLSNTYFGLIWIYQLICLPLILWIVRGYFEDISADVEY
AYRIAGHSWFSTFRKIALPLAGPGIAAAGLLAFIFAWNNFVFALVLASADKQPVTVGALA
FVTASGIQYGQIAAAIVLSITPTLALALYAQRYLVEGLSLGAVKG