Protein Info for SMc01621 in Sinorhizobium meliloti 1021
Annotation: L-fuculose phosphate aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to FUCA_HAEIN: L-fuculose phosphate aldolase (fucA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 100% identity to sme:SMc01621)Predicted SEED Role
"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"
MetaCyc Pathways
- lactate biosynthesis (archaea) (3/5 steps found)
- superpathway of fucose and rhamnose degradation (8/12 steps found)
- D-arabinose degradation II (2/4 steps found)
- L-fucose degradation I (2/4 steps found)
- nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
- superpathway of pentose and pentitol degradation (21/42 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.17
Use Curated BLAST to search for 4.1.2.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92NH2 at UniProt or InterPro
Protein Sequence (222 amino acids)
>SMc01621 L-fuculose phosphate aldolase (Sinorhizobium meliloti 1021) MNELQLRQSIIDHCRHMNAIGLNQGTSGNISLRHGGTMLITPSAIPYAEMTPDMIVAMPI EGEYGAWVGPKKPSVEWPFHLDILRARPDVGAVVHTHASFSTILAMARKPIPACHYMIAA FGGSDVRVADYARYGTKALSENVLKAMEGRSACLMANHGMIATGSSLEKAMWAAVELETI AKQYYHVLLIGGPVVLPQEEIAGVIEGFATYGHQDKPKGEAA