Protein Info for SMc01567 in Sinorhizobium meliloti 1021

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 TIGR01391: DNA primase" amino acids 3 to 424 (422 residues), 425.8 bits, see alignment E=8.3e-132 PF01807: Zn_ribbon_DnaG" amino acids 5 to 101 (97 residues), 95.1 bits, see alignment E=5.7e-31 PF08275: DNAG_N" amino acids 127 to 254 (128 residues), 140.8 bits, see alignment E=7.9e-45 PF13662: Toprim_4" amino acids 265 to 331 (67 residues), 71.8 bits, see alignment E=1.4e-23 PF01751: Toprim" amino acids 267 to 343 (77 residues), 40.8 bits, see alignment E=6.2e-14 PF13155: Toprim_2" amino acids 270 to 355 (86 residues), 71.4 bits, see alignment E=2e-23 PF10410: DnaB_bind" amino acids 376 to 426 (51 residues), 30.5 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to sme:SMc01567)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92N97 at UniProt or InterPro

Protein Sequence (667 amino acids)

>SMc01567 DNA primase (Sinorhizobium meliloti 1021)
MRFSPSFLDEIRDRVPISDVIGKRVTWDRRKTNVSRGDYWACCPFHGEKSPSFHCEDRKG
RYHCFGCGVSGDHFRFLTELEGLSFPEAVQQIADLAGVPMPQPDPQAEQRERERTSLLDV
MELATQFFQDQLQTANGAKARAYLRERGLTGRTIETFRLGFAPDSRNALKEFLAGKGIGK
EQIEACGLVVHGDGIPVSYDRFRDRIMFPIPSAREKVIAFGGRAMSPDAPAKYLNSNETE
LFHKGNVLFNFARARRASQGADGAGTIIAVEGYMDVIALHQAGIENAVAPLGTALTENQL
DLLWKMTTQPVLCFDGDGAGVRAAHRAVDLALPHLKPGRSVRFALLPEGKDPDDVVRHDG
REPFDKVLANARSLADMVWQREVQGGDFDTPEKRAELEARLRQVTSVIADESVRRHYGQD
MRDRLNAFLQGSAPFRGERRPFERGGRQAGRQGGRGWSPAPNPVMGAAVEAGTAGSSKLN
QMLKAGGSLRPPVLRESVLALTIVNHPQLLFDEYDEIATIEFDHRDLQRCWAAVLNAAAA
NGLRLTRETLMEQLEAEGFSALIGALDQQVRYARLWTATAAAAPEDAREGYLQALTLHRR
TKALLWQKRELEREIAEATASEDVEQGQRLVRAMEEVQLELHRMDKLEAIIEGFGVLSGR
VKGPAAR