Protein Info for SMc01362 in Sinorhizobium meliloti 1021

Annotation: glycerol-3-phosphate acyltransferase PlsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 15 to 201 (187 residues), 175.2 bits, see alignment E=7e-56 PF02660: G3P_acyltransf" amino acids 19 to 191 (173 residues), 181.1 bits, see alignment E=9.3e-58

Best Hits

Swiss-Prot: 100% identical to PLSY_RHIME: Glycerol-3-phosphate acyltransferase (plsY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to sme:SMc01362)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QL7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>SMc01362 glycerol-3-phosphate acyltransferase PlsY (Sinorhizobium meliloti 1021)
MDMFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNR
KLAAATLLFDALKGTAAAAIASYWGVEAGIAAGFAAFLGHLFPVWLSFRGGKGVATYIGV
LLGLMPVMVLLFAAIWLAMAKITRYSSLSALVATAAVPIALYAAGNGKVAGLFAVMTAIA
WIKHRANIQRLLSGTESRIGEKG