Protein Info for SMc01291 in Sinorhizobium meliloti 1021

Annotation: 50S ribosomal protein L30

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 67 TIGR01308: ribosomal protein uL30" amino acids 11 to 65 (55 residues), 81.1 bits, see alignment E=1.7e-27 PF00327: Ribosomal_L30" amino acids 12 to 61 (50 residues), 63.6 bits, see alignment E=5.8e-22

Best Hits

Swiss-Prot: 100% identical to RL30_SINMW: 50S ribosomal protein L30 (rpmD) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: K02907, large subunit ribosomal protein L30 (inferred from 100% identity to smk:Sinme_1167)

MetaCyc: 46% identical to 50S ribosomal subunit protein L30 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L30p (L7e)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QF2 at UniProt or InterPro

Protein Sequence (67 amino acids)

>SMc01291 50S ribosomal protein L30 (Sinorhizobium meliloti 1021)
MAKKEVAKKTVTVEQIGSPIRRPAVQRQTLVGLGLNKMHRVRTLEDTPAVRGMIRAVQHL
VRVVDEK