Protein Info for SMc01269 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 65 to 83 (19 residues), see Phobius details PF13560: HTH_31" amino acids 21 to 77 (57 residues), 29.8 bits, see alignment E=1.2e-10 PF12844: HTH_19" amino acids 22 to 84 (63 residues), 38.8 bits, see alignment E=1.6e-13 PF07022: Phage_CI_repr" amino acids 24 to 84 (61 residues), 23.4 bits, see alignment E=1.2e-08 PF01381: HTH_3" amino acids 28 to 79 (52 residues), 45.5 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1189)

Predicted SEED Role

"PUTATIVE TRANSCRIPTION REGULATOR PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QD6 at UniProt or InterPro

Protein Sequence (132 amino acids)

>SMc01269 transcriptional regulator (Sinorhizobium meliloti 1021)
MLLSTENAIARLRETGDGDTLGGRIWRARDATGLSTKELASKLGVRNDTISSWERDRAEP
RANRLFMLAGVLGVTPAWLMAGIGRAPDDSTGDASGDELRKQLDLVKKLHEQTAEAIAAL
EMEFERLDQDVR