Protein Info for SMc01183 in Sinorhizobium meliloti 1021

Annotation: LexA repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF01726: LexA_DNA_bind" amino acids 2 to 63 (62 residues), 59.2 bits, see alignment E=2.8e-20 TIGR00498: repressor LexA" amino acids 2 to 237 (236 residues), 177.7 bits, see alignment E=1.1e-56 PF00717: Peptidase_S24" amino acids 116 to 231 (116 residues), 108.7 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 100% identical to LEXA_RHIME: LexA repressor (lexA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 100% identity to smk:Sinme_1511)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PW3 at UniProt or InterPro

Protein Sequence (238 amino acids)

>SMc01183 LexA repressor (Sinorhizobium meliloti 1021)
MLTRKQQELLLFIHERMKESGVPPSFDEMKDALDLASKSGIHRLITALEERGFIRRLPNR
ARALEVIKLPEAYAGASQVRRGFSPSVIEGSLGKPAAPPPAPKPAPPAEAASVAVPVMGR
IAAGVPISAIQNNMHDISVPVEMIGSGEHYALEIKGDSMIEAGILDGDTVIIRNGSTASP
GDIVVALIDDEEATLKRFRRKGASIALEAANPAYETRIFGPDRVKIQGRLVGLIRRYH