Protein Info for SMc01109 in Sinorhizobium meliloti 1021

Annotation: S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 4 to 121 (118 residues), 94.8 bits, E=5.9e-31
• TIGR01034: methionine adenosyltransferase
  • amino acids 6 to 410 (405 residues), 442.5 bits, E=6e-137
• PF02772: S-AdoMet_synt_M
  • amino acids 136 to 255 (120 residues), 124.9 bits, E=2.9e-40
• PF02773: S-AdoMet_synt_C
  • amino acids 257 to 399 (143 residues), 219.9 bits, E=1.7e-69

Best Hits

Swiss-Prot: 68% identical to METK_NITHX: S-adenosylmethionine synthase (metK) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to smk:Sinme_0044)

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• L-methionine degradation I (to L-homocysteine) (2/3 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (4/12 steps found)
• L-methionine salvage cycle III (2/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See Q92SI4 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SMc01109 S-adenosylmethionine synthetase (Sinorhizobium meliloti 1021)
MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKTGVDPWTVRIACETLATTNRVV
IAGEVRLPPSLLKKDKNGNDVINPSKFKSAARKAIRDIGYEQDGFHWKTAKIDVLLHFQS
AHIAQGVDNAADKQGEEGAGDQGIMFGYACRETAELMPAPIYYSHRILNLLAAARKKGEG
EVAKLGPDAKSQVTVRYVDGKPAEATSIVLSTQHLDESWDSTKVRSVVEPYIREALGDLK
IADDCTWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDTTKVDRSAA
YAARYLAKNVVAAGLAERCTIQLSYAIGVAQPLSIYVDLHGTGKVSEDQVESAIRKTMDL
SPTGIRRHLDLNRPIYAKTSAYGHFGRKAGRDGSFSWEKLDLVKPLKEAIDSDSSSVNGR
AASRAA