Protein Info for SMc01102 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details PF02646: RmuC" amino acids 90 to 369 (280 residues), 198.6 bits, see alignment E=6.4e-63

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 100% identity to smk:Sinme_0051)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SH7 at UniProt or InterPro

Protein Sequence (401 amino acids)

>SMc01102 hypothetical protein (Sinorhizobium meliloti 1021)
MEPVPFSFDQPLFLIGTLPVTAGHLVTTAALLVVLFSAIMVRRARSARATGREEQMSALI
AAQTEMQGRIAAMTEVLGARQAELNQSLSQRIDGMTHRIGASISEQTKATHENLRRLQER
LAVIDNAQNNIQSLAKDMAGLQSILANKQTRGAFGQSRMEAIVADGLPMGAFAFQATLSN
GARPDCTIRMPNGQPPLVIDAKFPLEAWNSMRDAASAERRQQAAQAFRRDMEVHIRDIAG
KYLLPGETQDTAFLFVPSESIFAEIHEHFEAVVQKAHRQRIVIVSPSLLLLSIQVIQAIL
KDARMREQAHLIQSEVVRLMEDLSRLDERVRKLQGHFAMTQKDVEDILISSDKLTRRGAK
IEALELQAEADPRQGEKPGDGSGRPMDGRMGQLKLRVVDED