Protein Info for SMc01100 in Sinorhizobium meliloti 1021

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00460: methionyl-tRNA formyltransferase" amino acids 4 to 302 (299 residues), 249.5 bits, see alignment E=2.2e-78 PF00551: Formyl_trans_N" amino acids 5 to 182 (178 residues), 122.2 bits, see alignment E=2.2e-39 PF02911: Formyl_trans_C" amino acids 206 to 302 (97 residues), 84.9 bits, see alignment E=3.9e-28

Best Hits

Swiss-Prot: 100% identical to FMT_RHIME: Methionyl-tRNA formyltransferase (fmt) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 100% identity to sme:SMc01100)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SH5 at UniProt or InterPro

Protein Sequence (311 amino acids)

>SMc01100 methionyl-tRNA formyltransferase (Sinorhizobium meliloti 1021)
MPLRMIFMGTPEFSVPTLLALAGAGHEIAAVYTQPPRPGGRRGLDLQKSPVHQAAERLGI
PVLTPANFKDAADRQTFRDFGADVAVVVAYGLLLPEEILSGTRYGCYNGHASLLPRWRGA
APIQRAIMAGDRETGMMVMKMDKGLDTGPVALAQSVPIDGMMRAGELHDRLMQVGAVLMT
EAMARLESGELPLAPQAQEGVAYAAKISKEETRIDFSRPAAEVHNHIRGLSPFPGAWFEL
DIAGRRERVKVLASEMSEGEGDPGEVLDHTLGIACGEGAVRLTRLQRAGGKALAAADFLR
GTPIAAGARIA