Protein Info for SMc01046 in Sinorhizobium meliloti 1021

Annotation: potassium transporter peripheral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF02254: TrkA_N" amino acids 3 to 125 (123 residues), 84.2 bits, see alignment E=2.6e-27 amino acids 236 to 354 (119 residues), 81.1 bits, see alignment E=2.4e-26 PF02080: TrkA_C" amino acids 157 to 227 (71 residues), 35.9 bits, see alignment E=1.7e-12 amino acids 385 to 451 (67 residues), 56.4 bits, see alignment E=6.8e-19

Best Hits

Swiss-Prot: 57% identical to TRKA_AZOC5: Trk system potassium uptake protein TrkA (trkA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to smk:Sinme_1263)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Q86 at UniProt or InterPro

Protein Sequence (458 amino acids)

>SMc01046 potassium transporter peripheral membrane protein (Sinorhizobium meliloti 1021)
MKVIICGAGQVGYGIAERLSRENNDVSVIDTSAALIAYITETLDVRGYVGHGAHPDVLAK
AGADQADMLIAVTLYDEVNIVACEVAHAIFNVPTKVARIRAQSYLAPEYSDLFSRENVPI
DVTISPEIEVGRLVLRRISFPGATDVVRFADDRIAMVAIECMEDCPVVDTPLQQLSELFP
DLHATVTGIFRDGKLIVPHSSDQLKTGDLAYVVCDRDHARRTLALFGHEEQEARRIIILG
AGNIGYFVARTIEEQQPRMRVKLVENDRDRAVLVADKLNSTVVLHGSAMDQRILAQADVQ
EADLVVALTNNDQINILGSMLARRLGAKSTLVLINEPAYQDFAGAAGVDAYINPRAVTIS
RVLQHVRKGRIRSVYAVQNGMAEVIEAEALETSPLVGKALRELELPEGIRIGALYRDKAY
VRPDGNTRIKAKDRVVLLAAAETVRDVEQLFRVSIQYF