Protein Info for SMc01037 in Sinorhizobium meliloti 1021

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16881: LIAS_N
  • amino acids 8 to 66 (59 residues), 32 bits, E=1.5e-11
• TIGR00510: lipoyl synthase
  • amino acids 21 to 309 (289 residues), 367.6 bits, E=2.4e-114
• PF04055: Radical_SAM
  • amino acids 81 to 244 (164 residues), 77.6 bits, E=1.3e-25

Best Hits

Swiss-Prot: 100% identical to LIPA_RHIME: Lipoyl synthase (lipA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to smk:Sinme_1253)

MetaCyc: 51% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

• lipoate biosynthesis and incorporation I (2/2 steps found)
• lipoate biosynthesis and incorporation III (Bacillus) (2/3 steps found)
• lipoate biosynthesis and incorporation V (mammals) (2/3 steps found)
• lipoate biosynthesis and incorporation IV (yeast) (4/7 steps found)
• lipoate biosynthesis and incorporation II (1/3 steps found)

KEGG Metabolic Maps

• Lipoic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

See Q92Q94 at UniProt or InterPro

Protein Sequence (322 amino acids)

>SMc01037 lipoyl synthase (Sinorhizobium meliloti 1021)
MVTVFDAVSDRAQRVRHPEKAHRPDTEVLRKPDWIRVKAPTSKGYQETRSIVKSHKLVTV
CEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDLDEPANVAKAVKQMG
LSHVVITSVDRDDLDDGGAEHFEKVIFAIREASPETTIEILTPDFLRKPGALERVVAAKP
DVINHNLETVPSNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQL
MDDLRTADVDFLTIGQYLQPSRKHHKVEKFVTPEEFKSYETVAYTKGFLMVSSSPLTRSS
HHAGDDFARLKAARERKLAAAE