Protein Info for SMc01017 in Sinorhizobium meliloti 1021

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00583: Acetyltransf_1" amino acids 28 to 130 (103 residues), 69.2 bits, see alignment E=7.6e-23 PF13673: Acetyltransf_10" amino acids 43 to 135 (93 residues), 43.6 bits, see alignment E=5.7e-15 PF13480: Acetyltransf_6" amino acids 44 to 115 (72 residues), 22.6 bits, see alignment E=2.1e-08 PF13508: Acetyltransf_7" amino acids 50 to 132 (83 residues), 58.2 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 54% identical to IAAT_AZOBR: IAA acetyltransferase from Azospirillum brasilense

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 99% identity to smk:Sinme_1232)

Predicted SEED Role

"IAA acetyltransferase (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QA6 at UniProt or InterPro

Protein Sequence (156 amino acids)

>SMc01017 acetyltransferase (Sinorhizobium meliloti 1021)
MTAVTIAEESPRQPAVIRLLELSDAYAASLYPAESNHLVDLSQLEQPTVSFFVARRDGEV
VGCCGLVEAGDGTAEIKRMFVDPEARGLKLGKLLLSVLEAKAAKLGLTAIRLETGIYQPE
AIGLYKASGYVECAPFGSYLPDPLSLFMEKPVRQEA