Protein Info for SMc01013 in Sinorhizobium meliloti 1021
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1228)Predicted SEED Role
"Nitrilotriacetate monooxygenase component B (EC 1.14.13.-)" in subsystem Aromatic Amin Catabolism (EC 1.14.13.-)
KEGG Metabolic Maps
- 1,4-Dichlorobenzene degradation
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Bisphenol A degradation
- Brassinosteroid biosynthesis
- Carotenoid biosynthesis - General
- Cyanoamino acid metabolism
- Flavonoid biosynthesis
- Histidine metabolism
- Isoflavonoid biosynthesis
- Limonene and pinene degradation
- Methane metabolism
- Naphthalene and anthracene degradation
- Phenylalanine metabolism
- Phenylpropanoid biosynthesis
- Styrene degradation
- Toluene and xylene degradation
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.14.13.-
Use Curated BLAST to search for 1.14.13.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92QA7 at UniProt or InterPro
Protein Sequence (200 amino acids)
>SMc01013 hypothetical protein (Sinorhizobium meliloti 1021) MFYDTAGNGHGLPHDPFKAIVSPRPIGWIGTRGADGALNLGPYSFFNAISDRPKLVMFAS SGYKDSVRNIEATGEFTASFASRNLSEAVNLTSVAAPHGESEFEIAGLTPVEGTLVKAPF VGEAFAALECRMTEIFRPKGIDGVVSDSYVVIGAVVGIHIREEAIRDGRFDMATVKPLAR LGYMDYCDGGDVFEMMRPVR