Protein Info for SMc00991 in Sinorhizobium meliloti 1021

Annotation: putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 36 to 281 (246 residues), 49.8 bits, see alignment E=7.5e-17 PF13416: SBP_bac_8" amino acids 38 to 310 (273 residues), 102.8 bits, see alignment E=4.6e-33 PF13343: SBP_bac_6" amino acids 72 to 299 (228 residues), 60.2 bits, see alignment E=3.4e-20

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to sme:SMc00991)

Predicted SEED Role

"Predicted polyamine sensor NspS, involved in biofilm formation" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RK9 at UniProt or InterPro

Protein Sequence (346 amino acids)

>SMc00991 putrescine-binding periplasmic protein (Sinorhizobium meliloti 1021)
MKARGVISVFLATLLCASASRAETLNLLIWEDYIDEGLIDRWTEKTGVSIRQINFDSDDA
RDEILADPGRNIDLVIVDENGATLFGRKGIIEPLSETNLPALEDYAPEWRKSCAGYGLPY
FWGTVGILYRSDMVTPPPTSWRDMMRPAPALRKHIAMFADHSEIFVPPLMLLGASVNADD
TPTLKAAFALLKTQAPFVLTYDYVVTSIQDPALAGNIYLALGYSGDQHVLNSKAGKAGLW
RYSVPKEGTLSWLDCFSVTAASPRKQRALEFLNFIGSPEAAAANAIALNMPTASNAALKL
LPDTMRSDPEIYPPTEIMAKNQHHQELSVRSIEARRRIINTLANFQ