Protein Info for SMc00990 in Sinorhizobium meliloti 1021

Annotation: fosmidomycin resistance antibiotic resistance transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 357 (334 residues), 123.9 bits, see alignment E=3.6e-40 amino acids 242 to 394 (153 residues), 43.4 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 56% identical to FSR_ECOLI: Fosmidomycin resistance protein (fsr) from Escherichia coli (strain K12)

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 100% identity to smk:Sinme_0568)

MetaCyc: 56% identical to fosmidomycin efflux pump (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-41

Predicted SEED Role

"Major facilitator transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RK8 at UniProt or InterPro

Protein Sequence (398 amino acids)

>SMc00990 fosmidomycin resistance antibiotic resistance transmembrane protein (Sinorhizobium meliloti 1021)
MATVTSAGSISPEKTAFSVILAVSFCHMLNDIMQSLLTALYPLLKENYALDFVQIGLLTF
TFQVTASMLQPAIGIVTDRWALPYSLPFAMLSTCMGLLLLANADHFWMLLLAASLIGIGS
AIFHPESSRVARLASGGRHGLAQSLFQVGGNAGSALGPLLAAFIVLPFGQGSLGWFSIVA
ITGFFVLSWVSMWYVRHRRATMSRPVPSRALPLPKTRVLWTIAILVLLTATKNVYLTSIS
SYFTFFVIERFDTSVQQAQLMLFLFLGSAAAGTFLGGPIGDRYGARFVIWFSILGVVPFT
LLLPYANLFWTGVLSVIIGLIFSSAFSAIVVFAQELVPGRVGLIAGVFFGFAFGAGGMGA
AVLGIFADRQGIEFVYKICSYLPLLGLLTVFLPKLPAR