Protein Info for SMc00892 in Sinorhizobium meliloti 1021

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 18 to 323 (306 residues), 286.4 bits, E=1.4e-89
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 18 to 296 (279 residues), 184.8 bits, E=1.1e-58

Best Hits

Swiss-Prot: 100% identical to LPXK_RHIME: Tetraacyldisaccharide 4'-kinase (lpxK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to smk:Sinme_0521)

MetaCyc: 51% identical to tetraacyldisaccharide 4'-kinase (Brucella abortus 2308)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (6/6 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See Q92RP7 at UniProt or InterPro

Protein Sequence (346 amino acids)

>SMc00892 tetraacyldisaccharide 4'-kinase (Sinorhizobium meliloti 1021)
MVSEAPPFWWTKADWRAYALWPFSWVYGRIAGMRMDRARRATSAVPLICIGNFTVGGAGK
TPTAIAIARAARARGLKPAFLSRGYGGSLDVTTVVDPEHHRARDVGDEPLLLAREALTVI
CRRRVDGARKLAAEGADIIIMDDGFQSARLVFDFALLVVDSGRGIGNGHLVPSGPVRAPI
GNQLRHANALLKLGHGSAADPLVRRAARAGKPVYVAETVRTDAGSLDGVKVLAWAGIADP
EKFFKTVRETGAVIEETRSFPDHHHFSEDEIADLIDRAASRGYTLVTTAKDMVRLEPGHG
RAGELAAKSRVIEIEVRFDDPAAPGKIIDAALASARARRLRERKAG