Protein Info for SMc00790 in Sinorhizobium meliloti 1021

Annotation: peptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00005: ABC_tran" amino acids 30 to 181 (152 residues), 116.6 bits, see alignment E=1.4e-37

Best Hits

Swiss-Prot: 46% identical to OPPF_STRMU: Oligopeptide transport ATP-binding protein OppF (oppF) from Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

KEGG orthology group: K12372, dipeptide transport system ATP-binding protein (inferred from 100% identity to sme:SMc00790)

MetaCyc: 38% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RV6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SMc00790 peptide ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTHVLEARNLVRDYHIPGNLFRKARTVHALKGVSFTVDEGKTLAIVGESGCGKSTLGRII
TLIDPATAGELLIDGKTVDIAREGLTAEMRRKVQIVFQNPYGSLNPRQKIGDILAEPLII
NTKVPAGERRERAMAMLKKVGLEEKHYNRYPHMFSGGQRQRIAIARALMLNPKLLVLDEP
VSALDLSVQAQVLNLLADLQDEFKLTYVFISHDLSVVRYIADDVMVMYYGEAVEYGSRDA
VFSDPQHDYTKTLFAATPRADVASIKARLARKNAA