Protein Info for SMc00787 in Sinorhizobium meliloti 1021

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 133 to 162 (30 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 256 to 284 (29 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 102 (102 residues), 48.5 bits, see alignment E=9.6e-17 PF00528: BPD_transp_1" amino acids 114 to 334 (221 residues), 148 bits, see alignment E=2.7e-47

Best Hits

Swiss-Prot: 60% identical to DPPB_ECOL6: Dipeptide transport system permease protein DppB (dppB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K12369, dipeptide transport system permease protein (inferred from 100% identity to sme:SMc00787)

MetaCyc: 60% identical to dipeptide ABC transporter membrane subunit DppB (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RV9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SMc00787 peptide ABC transporter permease (Sinorhizobium meliloti 1021)
MFRFLLGRLAVLIPTFIGVSIIAFSFIRLLPGDPVALLSGERVMSPERHAEISHQLGFDR
PIVMQYLDYLWGVLQGDFGTSIVTKKPVIDQFMELFPATVELSLCAIIFAVVVGIPAGVV
AAVKRGSIFDQIIMGTALIGFSMPIFWWGLLLIIVVSGILQWTPVSGRISLMFFFPSVTG
FMLVDSLLSGQEGAFQSAFNHLILPTIVLGTIPLAVIARQTRSAMLEVLSEDYVRTARAK
GLSTFRVVGIHALRNAMIPVVTTIGLQIGVMLAGAILTETIFSWPGIGKWMVDSVFRRDY
AVIQGGLLIIAAVIMLVNLAVDLLYGLINPRIRH