Protein Info for SMc00691 in Sinorhizobium meliloti 1021

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF02899: Phage_int_SAM_1" amino acids 9 to 91 (83 residues), 80.4 bits, see alignment E=1.5e-26 PF13495: Phage_int_SAM_4" amino acids 10 to 85 (76 residues), 29.3 bits, see alignment E=1.4e-10 TIGR02225: tyrosine recombinase XerD" amino acids 11 to 304 (294 residues), 336.6 bits, see alignment E=6.4e-105 PF00589: Phage_integrase" amino acids 126 to 291 (166 residues), 148.5 bits, see alignment E=2.5e-47

Best Hits

Swiss-Prot: 100% identical to XERD_RHIME: Tyrosine recombinase XerD (xerD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to smk:Sinme_2737)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ME3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>SMc00691 site-specific tyrosine recombinase XerD (Sinorhizobium meliloti 1021)
MTDMSAAYVEAFLEMMSAERGAAANTLQSYERDLEDARSFLRSRGTGLTDASADDLRSYL
SHLAGQGFKASSQARRLSALRQFYKFLYAEGLRTDDPTGILDAPKKARTLPKTLSIEDVT
RLIGQAEAEAKSGSDDVMAKLRMHALIELLYATGMRVSELVSLPASVLAQNGRFLIIRGK
GNKERLVPLSQAAIRAMRAYGEALQEESADSPWLFPSNGKSGHLPRQVFARDLKSLAARA
GIRVAAISPHVLRHAFASHLLANGADLRAVQELLGHSDISTTQIYTHVLEERLHDLVQNH
HPLAKQAKKQD