Protein Info for SMc00659 in Sinorhizobium meliloti 1021

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF00733: Asn_synthase" amino acids 11 to 117 (107 residues), 27.7 bits, see alignment E=5.6e-10 PF03054: tRNA_Me_trans" amino acids 14 to 216 (203 residues), 243.8 bits, see alignment E=3.4e-76 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 14 to 375 (362 residues), 302.9 bits, see alignment E=1.3e-94 PF20259: tRNA_Me_trans_M" amino acids 234 to 285 (52 residues), 59.5 bits, see alignment 4.8e-20 PF20258: tRNA_Me_trans_C" amino acids 294 to 375 (82 residues), 47.1 bits, see alignment E=6.3e-16

Best Hits

Swiss-Prot: 100% identical to MNMA_RHIME: tRNA-specific 2-thiouridylase MnmA (mnmA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to smk:Sinme_2768)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92MB5 at UniProt or InterPro

Protein Sequence (398 amino acids)

>SMc00659 tRNA-specific 2-thiouridylase MnmA (Sinorhizobium meliloti 1021)
MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC
AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD
LLATAKELGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSYFLFATTQEQIDYL
RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL
DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDSRSRRVIVGPKEALETRRVYLRDV
NWLGDEELEAAAGQGFECFAKVRSTRRPAPAVLKSDAEGLYVELVEGEAGVAPGQACALY
SGTGEDARVYGGGFIRRSEREPAAEAALKALLQAPAAA