Protein Info for SMc00598 in Sinorhizobium meliloti 1021

Annotation: branched chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 229 to 267 (39 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 288 (280 residues), 83.4 bits, see alignment E=7.6e-28

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to sme:SMc00598)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QX6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SMc00598 branched chain amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MAYFLQQIANAVPVAALYAALAFGYAIAFAVTRRADLTYGALFAFAGQIFVLFADVGWNR
LWLVLPAALGLGATAALAFGLGAGLIAGRYVMRPLAFSSANAVVVASLGSLLVLMETARL
ASDTRSLWLPPFLNDVVVFWPNPAFPVALTVVQLVNTALMMALVAGGHWLLTRSYAGRYW
RAVSEDRKAAALCGIDPGAVYIAAYGVASLIAAFCGILAASYYGNMDFGTGLTFGVKVLF
IAAIGGQTSPLFAALGAAGIGLMETVWSAYGPILWRDFAIFGFLVIVLVVTRREKIIP