Protein Info for SMc00594 in Sinorhizobium meliloti 1021

Annotation: beta-etherase (BETA-aryl ether cleaving enzyme) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF13417: GST_N_3" amino acids 15 to 84 (70 residues), 35.8 bits, see alignment E=1.7e-12 PF13409: GST_N_2" amino acids 17 to 78 (62 residues), 32.5 bits, see alignment E=2.2e-11 PF13410: GST_C_2" amino acids 153 to 214 (62 residues), 33.5 bits, see alignment E=7.5e-12 PF00043: GST_C" amino acids 159 to 216 (58 residues), 23.1 bits, see alignment E=1.5e-08

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_0960)

Predicted SEED Role

"lignin beta-ether hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92QY0 at UniProt or InterPro

Protein Sequence (229 amino acids)

>SMc00594 beta-etherase (BETA-aryl ether cleaving enzyme) protein (Sinorhizobium meliloti 1021)
MTRKLYALSGTDTSRPFSPHVWKTKLSLAHKGLTFDIAPVGFTEIPRLEQGATKIVPLLR
DGEKLVSDSFDIALYLEEAYPDRPPLLSGEGGKAMARFVEGWSQTTLHPAIGRIAIMDIH
DSLDPIDRAYFRASREERFGRPLEAVAEAGRGDLETFSAKLEPIRHMLKFQPFLGGDRPL
FADYIVFGALQWARIVSPHRLLAAGDVVTDWFERCLDLHDGLGRSVTAA