Protein Info for SMc00563 in Sinorhizobium meliloti 1021

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 339 to 356 (18 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 399 to 424 (26 residues), see Phobius details amino acids 494 to 515 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 419 (396 residues), 42.1 bits, see alignment E=2.7e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0929)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R01 at UniProt or InterPro

Protein Sequence (531 amino acids)

>SMc00563 transporter (Sinorhizobium meliloti 1021)
MNAVAAPGSMRIGKSALYIAGSALLFLTQGLGMNLASANLAQVQGSLSATSVEAAWLAAA
YMAPNVSLSAALVKIRAQYGLRRFAEIGIVGFVIASLMNVFVSDLHSAVVVRFISGIAAA
PMSTLGFLYMLEAFPPARKLTVALALALTCTTLAAPITRLISPELIEIGQWHGLYTLEMA
LALIALPIIYLLPLTPVPHAKVIQRADILSYLLLAVGFGCVAVVLVMGRLYWWFEAPWLG
MLLALSVVTLTAVVLIELNREQPLIDIRWLASREIVHFAAVLLIFRLVASEQSAIATNFY
QLLGLQYDQLATLYWIILASSLGGGLLCAALMKPGHADAVHVLALGMLAAGAYMDSHATS
LTRPEQMYVSQALVAAGTALFLPPAMARGFTAALAKGPSYILSFIVVFLFTQSIGGLMGS
AAFGTFVTLREKFHANILAEQIVLSNPLVAQRIGQLSGAYAKAIVDRALLNGEGVALLGQ
TITREANILAYNDAFLLAAIIALFALAVLLIQIAVKQLARHDPDIVPAATS