Protein Info for SMc00514 in Sinorhizobium meliloti 1021

Annotation: monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to RUTF_VARPS: FMN reductase (NADH) RutF (rutF) from Variovorax paradoxus (strain S110)

KEGG orthology group: K13786, cob(II)yrinic acid a,c-diamide reductase [EC: 1.16.8.1] (inferred from 100% identity to sme:SMc00514)

MetaCyc: 49% identical to cob(II)yrinate a,c-diamide reductase monomer (Brucella melitensis)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
adenosylcobalamin salvage from cobalamin (5/5 steps found)
adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (26/36 steps found)
cobalamin salvage (eukaryotic) (4/8 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 1.16.8.1 or 1.6.8.- or 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PJ7 at UniProt or InterPro

Protein Sequence (175 amino acids)

>SMc00514 monooxygenase (Sinorhizobium meliloti 1021)
MYVRDIVPERDVLEKTRLDPITYRDAMSRMSSHVQLITAADGKERRGVTITASCSVSDDP
PTVLACLNAANRRNDIFSRGGSFALNLLGAQHHALAHAFSGRDQLDMERRFALGRWTQRT
TGAPILVEAIAAFDCRLIEVKEVATHLILIGEVVDVQLGPKQPPLIYVDRGYHTL