Protein Info for SMc00502 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02798: 4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase" amino acids 3 to 223 (221 residues), 359 bits, see alignment E=4.9e-112 PF03737: RraA-like" amino acids 25 to 172 (148 residues), 149.4 bits, see alignment E=4.6e-48

Best Hits

Swiss-Prot: 65% identical to LIGK_SPHSK: 4-carboxy-4-hydroxy-2-oxoadipate aldolase (ligK) from Sphingobium sp. (strain NBRC 103272 / SYK-6)

KEGG orthology group: K10218, 4-hydroxy-4-methyl-2-oxoglutarate aldolase [EC: 4.1.3.17] (inferred from 100% identity to sme:SMc00502)

MetaCyc: 60% identical to HMG aldolase monomer (Comamonas testosteroni)
4-hydroxy-4-methyl-2-oxoglutarate aldolase. [EC: 4.1.3.17]; 4.1.3.17 [EC: 4.1.3.17]

Predicted SEED Role

"4-carboxy-4-hydroxy-2-oxoadipate aldolase (EC 4.1.3.17)" (EC 4.1.3.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PI8 at UniProt or InterPro

Protein Sequence (224 amino acids)

>SMc00502 hypothetical protein (Sinorhizobium meliloti 1021)
MSVVHRNIERTDRSLADALAECGVATVHEAMGRTGLMQSYMRPVWRGARVAGTAVTVSIP
PADNWMIHVAVEQCREGDILVVAPTSPCDAGYFGELLATSLMVRGVRGLIIEAGVRDVSE
LEEIGFPVWSRFVSAQGTVKATLGSVNVPIVCAGATVAPGDVVIADDDGVMVVPKAQAEQ
AVAASRARLEKERKTRERLAAGELGLDIYDMRGALAAKGLKYID