Protein Info for SMc00486 in Sinorhizobium meliloti 1021

Updated annotation (from data): Glutaminase (EC 3.5.1.2)
Rationale: Specifically important for utilizing L-Glutamine. Automated validation from mutant phenotype: the predicted function (GLUTAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03814: glutaminase A
  • amino acids 14 to 313 (300 residues), 430.9 bits, E=1.1e-133
• PF04960: Glutaminase
  • amino acids 28 to 313 (286 residues), 394 bits, E=1.9e-122

Best Hits

Swiss-Prot: 100% identical to GLSA_RHIME: Glutaminase (glsA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 100% identity to smk:Sinme_1691)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Glutamine and D-glutamate metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.2

Sequence Analysis Tools

See Q92PH0 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SMc00486 Glutaminase (EC 3.5.1.2) (Sinorhizobium meliloti 1021)
MREPKPQEDLQAIIDDIYRELTPRLGEGKVADYIPQLARVDARHFGMAIVTTGGEVYRVG
DAEMPFSIQSISKVFTLTLALGKHGENIWNRVGREPSGSAFNSIVQLEHEGGKPRNPFIN
AGAIRISDLILAGHTPKELIGEIVRFVRYLADDENIVIDHEVARSETATGYRNIALANFM
RSFGRLDHPVEHVLGVYFHHCALAMTCSQLAKAGLFLAAGGTNPLTGHSVVSRQRARRIN
ALMLTCGHYDGSGDFAYRVGLPGKSGVGGGIMAVAPGKASIAVWSPGLNDYGNSLLGSLA
LEMLAARTGWSVFGP