Protein Info for SMc00468 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 11 to 84 (74 residues), 37.4 bits, E=1.1e-13

Best Hits

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 100% identity to smk:Sinme_1710)

Predicted SEED Role

"Phosphohistidine phosphatase SixA"

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

See Q92PF7 at UniProt or InterPro

Protein Sequence (178 amino acids)

>SMc00468 hypothetical protein (Sinorhizobium meliloti 1021)
MQDSVVPAFQLLLLRHARSGWALPGQSDFDRALDDIGFAEAELTAQSAADHRIRPDLILC
STAVRCRQTAEPLYRAFGEDIDIRYLDTLYTGPTTVYADLVEAHASRPSLMIIGHNPMME
ELFRRILGEERAAAALADGYPPAGMAVIDFAARPKAGTAWTATLSKFLVPAPEEAEKG