Protein Info for SMc00463 in Sinorhizobium meliloti 1021

Annotation: dihydroneopterin aldolase DHNA lyase folate biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 5 to 119 (115 residues), 71.6 bits, E=6.4e-24
• TIGR00525: dihydroneopterin aldolase
  • amino acids 5 to 119 (115 residues), 127 bits, E=4.9e-41
• PF02152: FolB
  • amino acids 7 to 119 (113 residues), 109.8 bits, E=5.4e-36

Best Hits

Swiss-Prot: 45% identical to FOLB_METEA: Dihydroneopterin aldolase (folB) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 100% identity to smk:Sinme_1715)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (38/59 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

See Q92PF2 at UniProt or InterPro

Protein Sequence (123 amino acids)

>SMc00463 dihydroneopterin aldolase DHNA lyase folate biosynthesis protein (Sinorhizobium meliloti 1021)
MTATYTITLKNCAFFARHGVLDEEEFLGQRFFVDAELVVDQGTALAEDCIDDTVHYGIAF
AEIERIVTGRRRYLIEALALEVAKTLCARFRQIRKAKVSIRKPNAPVPGILDYVEVTVEH
VAE