Protein Info for SMc00452 in Sinorhizobium meliloti 1021

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR01084: A/G-specific adenine glycosylase" amino acids 14 to 275 (262 residues), 308.1 bits, see alignment E=3.2e-96 PF00730: HhH-GPD" amino acids 48 to 172 (125 residues), 75.4 bits, see alignment E=6.3e-25 PF00633: HHH" amino acids 112 to 139 (28 residues), 29.8 bits, see alignment (E = 5.6e-11) PF14815: NUDIX_4" amino acids 245 to 356 (112 residues), 69.9 bits, see alignment E=2.5e-23

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to smk:Sinme_0636)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RF0 at UniProt or InterPro

Protein Sequence (366 amino acids)

>SMc00452 A/G-specific adenine glycosylase (Sinorhizobium meliloti 1021)
MMRDLPQAASAALLLEWYDRHHRDLPWRVPPAAARKGAVADPYRVWLSEVMLQQTTVQAV
KAYFEKFLALWPTVGDLAAADTEDVMKAWAGLGYYARARNLKKCAEAVARDHGGRFPDSE
EGLKALPGIGDYTAAAIAAIAFNRASAVLDGNVERVISRLHAVETPLPAAKPEMRALVQA
LTPADRPGDFAQAMMDLGATICTPKRPACSLCPFRTDCRALKTADPETFPRKAAKKEKPL
RLGAAFVAVDGLEAVYLRKRPETGLLGGMTEVPGTDWTSRRDGDTSIDAHPFPAEWEPCG
TVNHVFTHFELHLSVFRARVGRADIGEARTDTSGWWEPLASLRAQALPTVMKKAIAKAIP
HAFEAG