Protein Info for SMc00432 in Sinorhizobium meliloti 1021

Updated annotation (from data): 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30)
Rationale: Specifically important for utilizing m-Inositol.
Original annotation: myo-inositol catabolism protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF04962: KduI" amino acids 5 to 262 (258 residues), 379.3 bits, see alignment E=4.5e-118 TIGR04378: 5-deoxy-glucuronate isomerase" amino acids 16 to 262 (247 residues), 329.9 bits, see alignment E=5e-103

Best Hits

Swiss-Prot: 56% identical to IOLB_GEOKA: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 100% identity to smk:Sinme_3681)

MetaCyc: 47% identical to 5-deoxy-D-glucuronate isomerase (Bacillus subtilis subtilis 168)
RXN-14150 [EC: 5.3.1.30]

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.- or 5.3.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SM0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>SMc00432 5-deoxy-D-glucuronate isomerase (EC 5.3.1.30) (Sinorhizobium meliloti 1021)
MSRLLVKPKAQAGLMQEITPESAGWTYVGFALHRLQPGETAGGETGEKELCLVLVSGKAK
ISVDGEDFGELGERMTPFEGRPYAVYVPKGSSWQAEAATALDLAVCSAPGGEGFKAKVIR
PGTHPQMTRGKGTNTRYVTNIMPEDDGSAQSLLVVEVITPGGHTSSYPPHKHDEDNLPAE
SYLEETYYHRLNPPQGFAMQRVYTDDRSLDETMAVEDGDVTLVPKGYHPVAAIHGYDSYY
LNVMAGPKRIWKFHNAREHEWLFTGV