Protein Info for SMc00427 in Sinorhizobium meliloti 1021

Annotation: peptide chain release factor RF-3 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR00503: peptide chain release factor 3" amino acids 6 to 520 (515 residues), 658.5 bits, see alignment E=6.5e-202 PF00009: GTP_EFTU" amino acids 11 to 269 (259 residues), 179.5 bits, see alignment E=1.4e-56 PF01926: MMR_HSR1" amino acids 15 to 142 (128 residues), 26.7 bits, see alignment E=1.3e-09 TIGR00231: small GTP-binding protein domain" amino acids 15 to 153 (139 residues), 78 bits, see alignment E=6.9e-26 PF22042: EF-G_D2" amino acids 288 to 373 (86 residues), 84 bits, see alignment E=1.7e-27 PF03144: GTP_EFTU_D2" amino acids 306 to 372 (67 residues), 42.4 bits, see alignment E=1.9e-14 PF16658: RF3_C" amino acids 379 to 505 (127 residues), 139.8 bits, see alignment E=1.2e-44

Best Hits

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to smk:Sinme_3676)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SM5 at UniProt or InterPro

Protein Sequence (527 amino acids)

>SMc00427 peptide chain release factor RF-3 protein (Sinorhizobium meliloti 1021)
MAESIAEAVSRRRTFAIISHPDAGKTTLTEKLLLFGGAIQLAGEVKAKKDRIQTRSDWMK
IERERGISVVTSVMTFEYNDTVFNLLDTPGHEDFADDTYRTLTAVDAAVMVIDAAKGIEP
RTLKLFEVCRLRDIPIITFVNKMDRESRDPFEILDEVEQKLALDCAPVTWPIGRSKTFCG
TYHLATDEVRGADTQERLTKVNDPEMASHRLPENERDTFIEETSLAIEACKPFDRKAFLE
GHLTPVFFGSALRNFGVRDLINALADFAPPPRAQVADIRTVEATDDRMTAFVFKIQANMD
PNHRDRIAFVRVCSGKLERGMKARLSRTGKQMGLTAPQFFFASQRQLADTAFAGDVVGIP
NHGTLRIGDTLTEGEPLVFQGVPNFAPEILRRVRLEDAMKAKKLKEALQQMAEEGVVQLF
SPDDGAPAIVGVVGALQLDVLRERLQAEYSLPVSFEMSRFSICRWISAESPADLEKFIAT
HRGDIARDLDGDPVYLAQDGFSLRYESERYPAVKMVAIKEYHVAKAA