Protein Info for SMc00419 in Sinorhizobium meliloti 1021

Annotation: glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR01380: glutathione synthase" amino acids 6 to 313 (308 residues), 413.4 bits, see alignment E=2.5e-128 PF02951: GSH-S_N" amino acids 6 to 122 (117 residues), 143.8 bits, see alignment E=3.9e-46 PF02955: GSH-S_ATP" amino acids 126 to 297 (172 residues), 247.9 bits, see alignment E=6.3e-78 PF08443: RimK" amino acids 137 to 309 (173 residues), 64.4 bits, see alignment E=1.7e-21

Best Hits

Swiss-Prot: 100% identical to GSHB_RHIME: Glutathione synthetase (gshB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 100% identity to sme:SMc00419)

MetaCyc: 42% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.3

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SN3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SMc00419 glutathione synthetase (Sinorhizobium meliloti 1021)
MAGIVNVGVQMDHVSGITIAGDSTFAMSLEAQARGYRLFHYTPDKLSLRDGRVYATAQQM
QLRDVRGDHFTLGEDERIDLSTMDVILLRQDPPFDMAYITSTHLLERLHPKTLVVNDPAW
VRNSPEKIFVTEFPDLMPKTLITRDPDEIARFRQEMGDIILKPLYGNGGAGVFHSARDDR
NFSSLLEMFAQMFREPYIAQEYLPAVRKGDKRILLVDGEPVGAINRVPAEHDSRSNMHVG
GRAEATDLTAREREICTRIGPALKERGFLFVGIDVIGDYLTEINVTSPTGIREVKKFGGA
DVASLLWDAIEKKRA