Protein Info for SMc00372 in Sinorhizobium meliloti 1021

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 195 (189 residues), 163 bits, E=9e-52
• PF08659: KR
  • amino acids 10 to 170 (161 residues), 30 bits, E=7.1e-11
• PF13561: adh_short_C2
  • amino acids 13 to 251 (239 residues), 201.7 bits, E=2.1e-63

Best Hits

Swiss-Prot: 37% identical to RM1DH_PICST: L-rhamnose-1-dehydrogenase (DHG2) from Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3621)

MetaCyc: 37% identical to NAD+-dependent L-rhamnose 1-dehydrogenase (Scheffersomyces stipitis CBS 6054)
L-rhamnose 1-dehydrogenase. [EC: 1.1.1.173]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• 8-amino-7-oxononanoate biosynthesis I (8/11 steps found)
• stearate biosynthesis IV (4/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (3/5 steps found)
• biotin biosynthesis I (9/15 steps found)
• L-rhamnose degradation III (3/7 steps found)
• petroselinate biosynthesis (2/6 steps found)
• L-rhamnose degradation II (3/8 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.173

Sequence Analysis Tools

See Q92SS3 at UniProt or InterPro

Protein Sequence (256 amino acids)

>SMc00372 short chain dehydrogenase (Sinorhizobium meliloti 1021)
MSRLEGKIAIVTGASSGIGRAAALLFAREGAKVVVTARNGNALAELTDEIAGGGGEAAAL
AGDVGDEALHEALVELAVRRFGGLDTAFNNAGALGAMGEISSLSVEGWRETLDTNLTSAF
LAAKYQVPAIAALGGGSLTFTSSFVGHTAGFAGVAPYAASKAGLIGLVQALAVELGARGI
RVNALLPGGTDTPANFANLPGAAPETRGFVEGLHALKRIARPEEIAEAALYLASDGASFV
TGAALLADGGASVTKA