Protein Info for SMc00354 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details PF13441: Gly-zipper_YMGG" amino acids 31 to 79 (49 residues), 31 bits, see alignment 2.6e-11 PF13488: Gly-zipper_Omp" amino acids 39 to 84 (46 residues), 47.6 bits, see alignment 1.8e-16 PF00691: OmpA" amino acids 114 to 209 (96 residues), 81.9 bits, see alignment E=5.4e-27

Best Hits

Swiss-Prot: 49% identical to YIAD_ECOLI: Probable lipoprotein YiaD (yiaD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3604)

Predicted SEED Role

"Outer membrane lipoprotein omp16 precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92ST9 at UniProt or InterPro

Protein Sequence (221 amino acids)

>SMc00354 hypothetical protein (Sinorhizobium meliloti 1021)
MIKKCAILAVVAVYLSGCTTTDPYTGEQKMSNTAGGALIGAGLGAATGLLVGGSAAGRRD
AALVGAGIGALGGGLVGNYMDQQESELRAQLQGTGVSVTRAGDRIILNMPSNITFATDRD
QVIPAFYSTLDSVAIVLRKFNKTLIDVDGHTDSTGSASYNQGLSERRAASVANYLASRGV
DQRRMSAVGYGLERPIASNATEVGRAQNRRVEISIAPIKQG