Protein Info for SMc00334 in Sinorhizobium meliloti 1021

Annotation: cytidylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR00017: cytidylate kinase" amino acids 1 to 197 (197 residues), 171.9 bits, see alignment E=7.8e-55 PF02224: Cytidylate_kin" amino acids 5 to 196 (192 residues), 184.9 bits, see alignment E=1.7e-58 PF13207: AAA_17" amino acids 9 to 145 (137 residues), 28.9 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 100% identical to KCY_RHIME: Cytidylate kinase (cmk) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 100% identity to smk:Sinme_3581)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SV4 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SMc00334 cytidylate kinase (Sinorhizobium meliloti 1021)
MTFVIAIDGPAAAGKGTLSRRIAEQYGFHHLDTGLTYRATAKALMDAGLPLDDEAVAEKT
AREVDLSGLDRAVLSEHSIGEAASKIAVMPAVRRALVEAQRAFARKEPGTVLDGRDIGTV
VCPDAAVKLYVTASPEVRAKRRHDEIVAGGGKADYTAIFEDVKKRDGRDMGRADSPLRPA
EDAHLLDTSEMSIEAAFQAAKTLVDAALKEKI