Protein Info for SMc00324 in Sinorhizobium meliloti 1021

Annotation: polynucleotide phosphorylase/polyadenylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 TIGR03591: polyribonucleotide nucleotidyltransferase" amino acids 10 to 693 (684 residues), 1078.6 bits, see alignment E=0 PF01138: RNase_PH" amino acids 13 to 144 (132 residues), 115.9 bits, see alignment E=4.5e-37 amino acids 326 to 458 (133 residues), 103.1 bits, see alignment E=3.9e-33 PF03725: RNase_PH_C" amino acids 147 to 211 (65 residues), 51.6 bits, see alignment E=1.9e-17 amino acids 462 to 529 (68 residues), 22.4 bits, see alignment E=2.5e-08 PF03726: PNPase" amino acids 241 to 322 (82 residues), 72.9 bits, see alignment E=6.3e-24 PF00013: KH_1" amino acids 558 to 615 (58 residues), 45.9 bits, see alignment 9.8e-16 PF00575: S1" amino acids 620 to 692 (73 residues), 60.5 bits, see alignment E=4.2e-20

Best Hits

Swiss-Prot: 100% identical to PNP_RHIME: Polyribonucleotide nucleotidyltransferase (pnp) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00962, polyribonucleotide nucleotidyltransferase [EC: 2.7.7.8] (inferred from 100% identity to sme:SMc00324)

Predicted SEED Role

"Polyribonucleotide nucleotidyltransferase (EC 2.7.7.8)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Polyadenylation bacterial (EC 2.7.7.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92SW0 at UniProt or InterPro

Protein Sequence (717 amino acids)

>SMc00324 polynucleotide phosphorylase/polyadenylase (Sinorhizobium meliloti 1021)
MFETHKVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFPDGYKNDTQVIITVMQH
DLENNPDVVAMVAASAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDEMDESTLDLVVA
GTQEAVLMVESEAKELPEDVMLGAVVFGQKGFQPVIDAVIRLAEVAAKEPREFNPEDHSA
LENAMLSIAEDELRNAYKITEKAARYAAVDAVKAKVKEHFLPEGVENPAHTAEEIAAVFK
HLQAKIVRWNILDTKSRIDGRDLVTVRPIVAEVGILPRTHGSALFTRGETQAIVVATLGT
GEDEQYVDSLTGMYKENFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPTA
EQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLIKEDDRFAVL
SDILGDEDHLGDMDFKVAGTDAGITSLQMDIKIEGITEEIMGVALNQAKGGRLHILGEMA
KAISESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIDDDGTVKIA
SASAKEIEAARKWIHSIVAEPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASER
VAKTTDVVKEGDKVWVKLMGFDERGKVRLSMKVVDQATGKEVVAEKSEKKDGGEAAE