Protein Info for SMc00316 in Sinorhizobium meliloti 1021

Annotation: 2-octaprenyl-6-methoxyphenyl hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01494: FAD_binding_3
  • amino acids 26 to 330 (305 residues), 109.9 bits, E=6.8e-35
• TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family
  • amino acids 27 to 401 (375 residues), 305.6 bits, E=2.3e-95
• PF01134: GIDA
  • amino acids 27 to 59 (33 residues), 24.6 bits, see alignment (E = 5.2e-09)
• PF00890: FAD_binding_2
  • amino acids 27 to 54 (28 residues), 22.8 bits, see alignment (E = 1.9e-08)
• PF01266: DAO
  • amino acids 27 to 78 (52 residues), 31.7 bits, 5e-11
• PF13450: NAD_binding_8
  • amino acids 30 to 58 (29 residues), 22.6 bits, see alignment (E = 4.2e-08)

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to sme:SMc00316)

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Bisphenol A degradation
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Cyanoamino acid metabolism
• Flavonoid biosynthesis
• Histidine metabolism
• Isoflavonoid biosynthesis
• Limonene and pinene degradation
• Methane metabolism
• Naphthalene and anthracene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Styrene degradation
• Toluene and xylene degradation
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

See Q7APD3 at UniProt or InterPro

Protein Sequence (425 amino acids)

>SMc00316 2-octaprenyl-6-methoxyphenyl hydroxylase (Sinorhizobium meliloti 1021)
MRALQAVISRRKRATAWEVLSTMDHYDIAIIGAGLAGSLAAIALAREGHRVALVGPRPAI
ADGRTTALMDQSIEYLKKLDLWGEVEPLTAPLVAIRILDGTSRLFRAPPVNFRASEVGLD
AFGYNIPNAPFLEILERHEAGLPTLERATAAATRFDIDGAEVRIGLGDDRSITADLVVGA
DGRRSAVREAAGIGVRTWSYPQAAIVLNFSHELPHQDVSTEFHTEGGPFTQVPLPGNRSS
LVWVRKPRDAEETLTLAPDVLSRTIEDRMQSILGKVTTEGMPQSFPLSGLSARRFGKGRT
LLVGEAAHAFPPIGAQGLNLSLRDIMTLVDLIGRPTGSRLPADTGDRFDGRRRADILSRT
ASVDLLNRSLLSNFLPVQALRAAGLHLLSSAGPLRGLLMREGIHPGSALQAFKEGLREQI
RRKSA