Protein Info for SMc00256 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 33 to 181 (149 residues), 41.2 bits, see alignment E=2.3e-14 PF12833: HTH_18" amino acids 243 to 320 (78 residues), 68.4 bits, see alignment E=8.4e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1590)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PQ2 at UniProt or InterPro

Protein Sequence (335 amino acids)

>SMc00256 transcriptional regulator (Sinorhizobium meliloti 1021)
MRMIANRSPQSSIEVVVVVLPESSIMSFASVLDPMRAANRVAGHEVFRWRLLSADGQAVM
LTCGVPIAVDGSFTLPVVGDLLLIIGGFNLHRHAGKRFLATLQECARHFDIVAGVESGCW
LLGRSGLINGRKATAHWEELEDFSQAFPELEVIGDRFVIDGKYWTSGGASPTFDMMLHLV
AERLGPALALDVASIFVYDQMHGPTDVQPFVSLGRIEARDPELAAAIRLMERTLERPMTV
AALARRLSVSQRKLETLFAKGLSTSPGAYYLRLRLQVAHRLVRDTGIPMRDIALRCGFDS
LSAFSRAYRREYRTSALKMRSARGAGVTPDASDKG