Protein Info for SMc00197 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details PF00892: EamA" amino acids 8 to 140 (133 residues), 46.9 bits, see alignment E=1.8e-16 amino acids 150 to 276 (127 residues), 30.5 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMc00197)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PB3 at UniProt or InterPro

Protein Sequence (302 amino acids)

>SMc00197 hypothetical protein (Sinorhizobium meliloti 1021)
MRSSANFRGIVFMCLAMIGFACNDALVKSVTGAMNTGQIMFMRGLLTTLMVVVVAYRFGA
FRPVRTIFRPAILLRIAMEALASVTYISALGQIPLANASAIMQALPLAVTLGAALFLGEP
VGWRRWAAIVVGFAGVLIVLRPGPEGFTAAALTVVACVFCTATRDLCTRRIGTDVPSLYI
TVTTSLVTTLVGAALIVPLGGWQPMSATSLSHIAGASVLLMLGYQTIVLAMREGEISVIA
PFRYMSLLWSVTLGVVFFAETPDRWMLAGVAIIIGSGLYTFYRESKRGRQAVAQRALGGP
LE