Protein Info for SMc00192 in Sinorhizobium meliloti 1021

Annotation: ferredoxin, 2FE-2S FDII electron transport iron-sulfur protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF00111: Fer2" amino acids 10 to 90 (81 residues), 47.2 bits, see alignment E=8.7e-17

Best Hits

Swiss-Prot: 66% identical to FER2_CAUVC: 2Fe-2S ferredoxin (fdxB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 97% identity to smd:Smed_1536)

MetaCyc: 47% identical to diphenylamine dioxygenase ferredoxin component (Burkholderia sp. JS667)
RXN-11506

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PE9 at UniProt or InterPro

Protein Sequence (106 amino acids)

>SMc00192 ferredoxin, 2FE-2S FDII electron transport iron-sulfur protein (Sinorhizobium meliloti 1021)
MTKLTIVAFDGARHELDVENGSTVMENAVRNSVPGIEAECGGACACATCHVYVDDAWAAQ
VGTPEAMEEDMLDFAYDVRPTSRLSCQIKMSEALDGLVVHVPERQA