Protein Info for SMc00172 in Sinorhizobium meliloti 1021

Annotation: TARNSPORT protein transmembrane

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 21 to 379 (359 residues), 33.2 bits, see alignment E=4.7e-12 PF07690: MFS_1" amino acids 32 to 346 (315 residues), 82.1 bits, see alignment E=5.9e-27 PF12832: MFS_1_like" amino acids 34 to 373 (340 residues), 167.2 bits, see alignment E=9.1e-53

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to smk:Sinme_1741)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PD3 at UniProt or InterPro

Protein Sequence (407 amino acids)

>SMc00172 TARNSPORT protein transmembrane (Sinorhizobium meliloti 1021)
MIPSSAPAFVAGPPPRHFALRIALLFSAPLIVNGFAMPYFPVWLSSLSLSDFEIGIVLAV
PMFVRVITAPLAGVLADRIGERTIVLIWSGILSFAGAVVLFYAQSFWPVLVIYTLQSAVY
SPYVPIVEAIALSGVRRWGFDYAQMRVWGSVAFIGATMLGGWLIGVVGGQMVLPAMAAGF
ALTILLAVAAPRVGRPRRPSPITAITEPPPQSLRQADLQLLLVGVTLVNSSHAMLFAFSA
IYWQHIGYSGTQIGILWSAGVSAEVLMFFLARAIVRRFSVWTMIFSGCLLAVVRWLIFPM
DLGFSGYFVLQCFHAFTYAIMHTGMQHKLVERVAEEQEASAQGLYFFYTGIFTAIFTFLS
GYFYAWFGVDGFYSMSAVALSGCLFTFLGWYLQPQRLASGGKTSEAS