Protein Info for SMc00162 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF07676: PD40" amino acids 26 to 43 (18 residues), 12.8 bits, see alignment (E = 1.5e-05) amino acids 102 to 136 (35 residues), 30.4 bits, see alignment 4.3e-11 amino acids 146 to 181 (36 residues), 40.3 bits, see alignment 3.5e-14

Best Hits

Swiss-Prot: 70% identical to Y1656_AGRFC: Uncharacterized protein Atu1656 (Atu1656) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to sme:SMc00162)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92K94 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SMc00162 hypothetical protein (Sinorhizobium meliloti 1021)
MRSSVEIFDIATGETRVVWQTERLVEAPNWSPDGKFLIINGDGRLYRLGFDGSDPTEIDT
GFARHCNNDHGISPDGSTLVISDKTEFGSSAIYLLPAEGGTPRLVTRNLPSYWHGWSPDG
RMLAYCGIRDQVFDIYTIPVDGGEERRLTQGQGRNDGPDWSADGEWIYFNSSRTGRMQIW
RVRPDGKDVQRITDSPYGDWFPHPSPDGRHLLVLSYDGDVFDHPRDLDVRLRLMDPDGGN
ARVLLELFGGQGTVNVPNWSPSGTAFAFVRYEPEE