Protein Info for SMc00154 in Sinorhizobium meliloti 1021

Annotation: glutathione reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 TIGR01424: glutathione-disulfide reductase" amino acids 4 to 450 (447 residues), 785.3 bits, see alignment E=6.8e-241 PF07992: Pyr_redox_2" amino acids 6 to 321 (316 residues), 200.8 bits, see alignment E=6.7e-63 PF13738: Pyr_redox_3" amino acids 127 to 305 (179 residues), 37.3 bits, see alignment E=3.9e-13 PF00070: Pyr_redox" amino acids 173 to 248 (76 residues), 67.6 bits, see alignment E=2.3e-22 PF02852: Pyr_redox_dim" amino acids 341 to 449 (109 residues), 110.3 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to smk:Sinme_1759)

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PC0 at UniProt or InterPro

Protein Sequence (463 amino acids)

>SMc00154 glutathione reductase (Sinorhizobium meliloti 1021)
MSAFDYDLFVIGGGSGGVRSGRLAAALGKKVAIAEEFRYGGTCVIRGCVPKKLYVYASQF
AEHFEDAAGFGWTVGESRFDWAKLVAAKEQEIARLEGLYRKGLANAGAEILDTRAELAGP
NTVKLLASGKTVTAERIVIAVGGHPSPHDALPGHELCITSNEAFDLPALPESILIAGGGY
IAVEFANIFHGLGVKTTLIYRGKEILSRFDQDMRRGLHAAMEEKGIRILCEDIIQSVSAD
ADGRRVATTMKHGEIVADQVMLALGRMPNTNGLGLEAAGVRTNELGAIIVDAFSRTSTPG
IYALGDVTDRVQLTPVAIHEAMCFIETEYKNNPTSPDHDLIATAVFSQPEIGTVGITEEE
AARKFQEIEVYRAEFRPMKATLSGRKEKTIMKLVVNAADRKVVGAHILGHDAGEMAQLLG
ISLRAGCTKDDFDRTMAVHPTAAEELVTMYQPSYRVRNGERVG