Protein Info for SMc00140 in Sinorhizobium meliloti 1021

Updated annotation (from data): L-lysine ABC transporter, substrate-binding component
Rationale: Specifically important for L-lysine utilization. The ATPase component is not encoded nearby and was not evident in the fitness data.
Original annotation: amino-acid binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 9 to 253 (245 residues), 260.9 bits, see alignment E=6.1e-82 PF00497: SBP_bac_3" amino acids 30 to 254 (225 residues), 154.2 bits, see alignment E=1.6e-49 PF10613: Lig_chan-Glu_bd" amino acids 73 to 122 (50 residues), 44.3 bits, see alignment 1.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1774)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PA9 at UniProt or InterPro

Protein Sequence (260 amino acids)

>SMc00140 L-lysine ABC transporter, substrate-binding component (Sinorhizobium meliloti 1021)
MRISRRLAATASAAVFVLMAGVAMAEGEKVVIGTEGAYPPFNNLESDGTLTGFDIDIAKA
LCEEMKAECTFVTQDWDGIIPALIAKKFDAIVASMSITEERKQQVDFTNKYYNTPPAIVV
PKDSPITEATAAALSGKALGAQGSTTHSNYAEAHMKESEVKLYPTADEYKLDLANGRIDA
AIDDVVVLSEWLKTEDGACCKLLGTLPIDPVINGEGAGIAIRKGDDALREKLNKAIEAIR
ANGKYKQINEKYFPFDVYGS