Protein Info for SMc00133 in Sinorhizobium meliloti 1021
Annotation: oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to Y1503_SHEFN: Uncharacterized oxidoreductase Sfri_1503 (Sfri_1503) from Shewanella frigidimarina (strain NCIMB 400)
KEGG orthology group: None (inferred from 100% identity to smk:Sinme_1781)MetaCyc: 35% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]
Predicted SEED Role
"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)
MetaCyc Pathways
- glycolate and glyoxylate degradation I (3/4 steps found)
- superpathway of glycol metabolism and degradation (5/7 steps found)
- D-glucarate degradation I (2/4 steps found)
- superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
- D-galactarate degradation I (1/4 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.60
Use Curated BLAST to search for 1.1.1.60
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92PA2 at UniProt or InterPro
Protein Sequence (289 amino acids)
>SMc00133 oxidoreductase (Sinorhizobium meliloti 1021) MAKVAFIGLGVMGYPMAGHLKARGGHDVTVYNRTAAKAEQWAAAFGGRTAATPAGAAKDQ DFVFACVGNDDDLRSVTTGENGAFETMAPGSVFIDNTTASAAVARELYAAAAAKGAHFID APVSGGQAGAENGVLTVMCGGDAGAFDKAKPVIEAYARMVGLMGPAGAGQLTKMINQICI AGLVQGLAEGIHFGKKAGLDIEKVIEVISKGAAGSWQMENRHKTMNEGKYDFGFAVDWMR KDLDIVLAEARHNGAKLPVTALVDQFYGDIQALGGNRWDTSSLLARLEK