Protein Info for SMc00101 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF00248: Aldo_ket_red" amino acids 14 to 257 (244 residues), 200.8 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 46% identical to DKGB_SALTY: 2,5-diketo-D-gluconic acid reductase B (dkgB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to sme:SMc00101)

MetaCyc: 36% identical to glyoxal/methylglyoxal reductase (Bacillus subtilis subtilis 168)
Aryl-alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.91]; 1.1.1.91 [EC: 1.1.1.91]; Methylglyoxal reductase (NADPH-dependent). [EC: 1.1.1.91, 1.1.1.283]

Predicted SEED Role

"oxidoreductase, aldo/keto reductase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.1.1.283 or 1.1.1.91

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RC6 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SMc00101 oxidoreductase (Sinorhizobium meliloti 1021)
MHAVSSNGANIPALGFGTFRMSGAEVLRILPQALKLGFRHVDTAQIYGNEAEVGEAIQKS
GIPRADVFLTTKVWVDNYRHDAFIASVDESLRKLRTDHVDLLLLHWPGSDVPMAERIGAL
NEVRNAGKVRHIGISNFNTTQMEEAARLSDAPIATNQVEYHPYLDQTKVLQTARRLGMSL
TSYYAMANGKVPADPLLTEIGGRHGKTAAQVALRWLVQQQDVIVLSKTATEARLKENFAI
FDFALTREEMAAVRELARPNGRIVNPQGLAPEWDA