Protein Info for SMa2412 in Sinorhizobium meliloti 1021

Annotation: RhrA transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF12833: HTH_18" amino acids 231 to 309 (79 residues), 64.4 bits, see alignment E=9.4e-22 PF00165: HTH_AraC" amino acids 276 to 308 (33 residues), 28.8 bits, see alignment 1e-10

Best Hits

Swiss-Prot: 100% identical to RHRA_RHIME: Transcriptional activator RhrA (rhrA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa2412)

Predicted SEED Role

"RhrA transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3Q6 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMa2412 RhrA transcriptional activator (Sinorhizobium meliloti 1021)
METIRPLKFGTLSLPDRESRLVCRSILLDMLGEATIAPDEGDLTGVTGLFWKYVSLSLAT
VYFPRTMLRVNASGMGDSGVVILRAMDSPLVIRHRRIKVEAARADVIFLPSDASSEITLP
EGGRFDCAHLPAYALASKRDLLKPIMMQPLAAECLPLQLLTNYAGYLLRQEYQSEEHAGM
MVAHFYDLLPVLAQDIGNVSPRETPHNRMASIKMRVEQNLANGSFSITDVAEAERITPRA
IQKFFSREGTTFSRYVLGRRLSLAKSLILAEGEATSISQIAYNVGFNDLSYFNRTFRSRY
GVRPSDLRRLAAAA