Protein Info for SMa2402 in Sinorhizobium meliloti 1021

Annotation: RhsB L-2,4-diaminobutyrate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF00282: Pyridoxal_deC" amino acids 100 to 421 (322 residues), 187.7 bits, see alignment E=1.4e-59

Best Hits

Swiss-Prot: 100% identical to RHBB_RHIME: L-2,4-diaminobutyrate decarboxylase (rhbB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K13745, L-2,4-diaminobutyrate decarboxylase [EC: 4.1.1.86] (inferred from 100% identity to sme:SMa2402)

MetaCyc: 100% identical to L-2,4-diaminobutyrate decarboxylase (Sinorhizobium meliloti Rm2011)
Diaminobutyrate decarboxylase. [EC: 4.1.1.86]

Predicted SEED Role

"Siderophore biosynthesis L-2,4-diaminobutyrate decarboxylase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3R1 at UniProt or InterPro

Protein Sequence (495 amino acids)

>SMa2402 RhsB L-2,4-diaminobutyrate decarboxylase (Sinorhizobium meliloti 1021)
MNINVAAFRTPPTKQTDHADQILGTDSESRRVFRNAMLQAIDMVVDQTAAASSLYSGTSF
QGLRGLIDDLDPLPEVGTGIAAALAEIGRPALEHAMVVGHPAAMAHLHCPVAVPALAAEV
LISATNQSLDSWDQSPFATLVEERVLACLTQLAELPASASGNFTSGGTQSNMTALYLAAV
RCGPDARKAGVVLTSAHAHFSIRKSAAILGFAEDAVIAIAADADGRMSVPALKAELLRVA
GEGRIPVAVVATAGTTDLGAIDPLVEIADLAAAQNVWMHVDAAYGGGLLFSRHRSRLEGL
EHAHSITLDFHKMLFQPISCGVLLLRDRADFAPLASKADYLNPEDAVFADAPNLVERSMQ
TTRRADALKILMTMRAIGRDGLDALICQTLQNTHAAAEAVKTREYLSLAGPPSLSTVLFR
YVSARGPKFADAITLKTRAALFNAGIAALATTVLDGRVHFKLTLLNPRSTPDVVHRILDA
IGETARELETHHARP